PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00118738001
Common NameGSBRNA2T00118738001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 307aa    MW: 34081.1 Da    PI: 9.2472
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00118738001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA62.54.9e-20224258135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  GSBRNA2T00118738001 224 CTHCETTKTPQWREGPRGPKTLCNACGVRFRSGRL 258
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-19218272IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-15222281No hitNo description
PROSITE profilePS5011411.912222254IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.8E-15222255IPR013088Zinc finger, NHR/GATA-type
CDDcd002029.08E-17223272No hitNo description
PfamPF003207.9E-18224258IPR000679Zinc finger, GATA-type
PROSITE patternPS003440224249IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MNNGSWLPEE DFKGLTDNFF DDLINHIDFP LEDIETTNEE GDWGADFKNL IPPPSDVLTS  60
LSSEFTRGGT NGNGQRVGAQ KKPVPTLKQQ SGISSTVETS LPDVKVSKMF QSSSPVSVLE  120
NAAANGSAAS FQNQNRAQRL AFPVKGIRSK RKRPTIPTFL SLHAFLSEML EKKLALLDDD  180
SDSEDTYNLS SESSAKKRRK KSNNNSNNSH CPEPFNADGT VRKCTHCETT KTPQWREGPR  240
GPKTLCNACG VRFRSGRLLP EYRPASSPTF IPTVHSNSHR KIIEMRRKEE EGQFVTGMPR  300
GFRYRG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195199KKRRK
2195200KKRRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.113140.0microspore
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00118738001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103677.10.0PREDICTED: GATA transcription factor 11 isoform X2
RefseqXP_013647671.10.0PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-102GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078ETN90.0A0A078ETN9_BRANA; BnaA07g13820D protein
STRINGBra011956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-85GATA transcription factor 11
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]